RAP2B (NM_002886) Human Mass Spec Standard
CAT#: PH304287
RAP2B MS Standard C13 and N15-labeled recombinant protein (NP_002877)
View other "RAP2B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAP2B MS Standard C13 and N15-labeled recombinant protein (NP_002877) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204287 |
Predicted MW | 20.5 kDa |
Protein Sequence |
>RC204287 protein sequence
Red=Cloning site Green=Tags(s) MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002877 |
RefSeq Size | 8413 |
RefSeq ORF | 549 |
Locus ID | 5912 |
Cytogenetics | 3q25.2 |
Summary | This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419033 | RAP2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419033 | Transient overexpression lysate of RAP2B, member of RAS oncogene family (RAP2B) |
CNY 3,080.00 |
|
TP304287 | Recombinant protein of human RAP2B, member of RAS oncogene family (RAP2B), 20 µg |
CNY 2,900.00 |