RAB30 (NM_014488) Human Mass Spec Standard
CAT#: PH304318
RAB30 MS Standard C13 and N15-labeled recombinant protein (NP_055303)
View other "RAB30" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RAB30 MS Standard C13 and N15-labeled recombinant protein (NP_055303) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204318 |
Predicted MW | 23.1 kDa |
Protein Sequence |
>RC204318 protein sequence
Red=Cloning site Green=Tags(s) MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQER FRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEF SEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055303 |
RefSeq Size | 9986 |
RefSeq ORF | 609 |
Locus ID | 27314 |
Cytogenetics | 11q14.1 |
Summary | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (By similarity). Required for maintaining the structural integrity of the Golgi apparatus, possibly by mediating interactions with cytoplasmic scaffolding proteins.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415246 | RAB30 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415246 | Transient overexpression lysate of RAB30, member RAS oncogene family (RAB30) |
CNY 3,080.00 |
|
TP304318 | Recombinant protein of human RAB30, member RAS oncogene family (RAB30), 20 µg |
CNY 2,900.00 |