SAV1 (NM_021818) Human Mass Spec Standard
CAT#: PH304389
SAV1 MS Standard C13 and N15-labeled recombinant protein (NP_068590)
View other "SAV1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SAV1 MS Standard C13 and N15-labeled recombinant protein (NP_068590) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204389 |
Predicted MW | 44.6 kDa |
Protein Sequence |
>RC204389 protein sequence
Red=Cloning site Green=Tags(s) MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDICLPDSSPNAFSTSGDVVSRN QSFLRTPIQRTPHEIMRRESNRLSAPSYLARSLADVPREYGSSQSFVTEVSFAVENGDSGSRYYYSDNFF DGQRKRPLGDRAHEDYRYYEYNHDLFQRMPQNQGRHASGIGRVAATSLGNLTNHGSEDLPLPPGWSVDWT MRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGTYYVDHTNKKAQYRHPCAPSVPRYDQPPPVT YQPQQTERNQSLLVPANPYHTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQI VKMYEAYRQALLTELENRKQRQQWYAQQHGKNF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068590 |
RefSeq Size | 3141 |
RefSeq ORF | 1149 |
Synonyms | SAV; WW45; WWP4 |
Locus ID | 60485 |
Cytogenetics | 14q22.1 |
Summary | WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein with two WW domains, a SARAH domain, and a coiled-coil region and is ubiquitously expressed in adult tissues. This protein binds to MST1 (mammalian sterile 20-like kinase 1) and promotes MST1-induced apoptosis. It has also been shown to bind to HAX1 (hematopoietic cell-specific protein 1 (HS1)-associated protein X-1) and to attenuate the anti-apoptotic effects of HAX1. Studies in human and mouse suggest this gene acts as a tumor suppressor. [provided by RefSeq, Aug 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402881 | SAV1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402881 | Transient overexpression lysate of salvador homolog 1 (Drosophila) (SAV1) |
CNY 3,080.00 |
|
TP304389 | Recombinant protein of human salvador homolog 1 (Drosophila) (SAV1), 20 µg |
CNY 2,900.00 |