THRSP (NM_003251) Human Mass Spec Standard
CAT#: PH304567
THRSP MS Standard C13 and N15-labeled recombinant protein (NP_003242)
View other "THRSP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | THRSP MS Standard C13 and N15-labeled recombinant protein (NP_003242) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204567 |
Predicted MW | 16.6 kDa |
Protein Sequence |
>RC204567 protein sequence
Red=Cloning site Green=Tags(s) MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDV DHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQE MTGQVW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003242 |
RefSeq Size | 1182 |
RefSeq ORF | 438 |
Synonyms | Lpgp; LPGP1; S14; SPOT14; THRP |
Locus ID | 7069 |
Cytogenetics | 11q14.1 |
Summary | The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401120 | THRSP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401120 | Transient overexpression lysate of thyroid hormone responsive (SPOT14 homolog, rat) (THRSP) |
CNY 3,080.00 |
|
TP304567 | Recombinant protein of human thyroid hormone responsive (SPOT14 homolog, rat) (THRSP), 20 µg |
CNY 2,900.00 |