THRSP (NM_003251) Human Recombinant Protein
CAT#: TP304567
Recombinant protein of human thyroid hormone responsive (SPOT14 homolog, rat) (THRSP), 20 µg
View other "THRSP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204567 protein sequence
Red=Cloning site Green=Tags(s) MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDV DHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQE MTGQVW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003242 |
Locus ID | 7069 |
UniProt ID | Q92748 |
Refseq Size | 1182 |
Cytogenetics | 11q14.1 |
Refseq ORF | 438 |
Synonyms | Lpgp; LPGP1; S14; SPOT14; THRP |
Summary | The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401120 | THRSP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401120 | Transient overexpression lysate of thyroid hormone responsive (SPOT14 homolog, rat) (THRSP) |
CNY 3,080.00 |
|
PH304567 | THRSP MS Standard C13 and N15-labeled recombinant protein (NP_003242) |
CNY 19,520.00 |