S100Z (NM_130772) Human Mass Spec Standard
CAT#: PH304754
S100Z MS Standard C13 and N15-labeled recombinant protein (NP_570128)
View other "S100Z" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | S100Z MS Standard C13 and N15-labeled recombinant protein (NP_570128) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204754 |
Predicted MW | 11.6 kDa |
Protein Sequence |
>RC204754 protein sequence
Red=Cloning site Green=Tags(s) MPTQLEMAMDTMIRIFHRYSGKARKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEV DFNEFVVMVAALTVACNDYFVEQLKKKGK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_570128 |
RefSeq Size | 1164 |
RefSeq ORF | 297 |
Synonyms | Gm625; S100-zeta |
Locus ID | 170591 |
Cytogenetics | 5q13.3 |
Summary | Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expression patterns. For additional background information on S100 proteins, see MIM 114085.[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408935 | S100Z HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408935 | Transient overexpression lysate of S100 calcium binding protein Z (S100Z) |
CNY 3,080.00 |
|
TP304754 | Recombinant protein of human S100 calcium binding protein Z (S100Z), 20 µg |
CNY 2,900.00 |