S100Z (NM_130772) Human Recombinant Protein
CAT#: TP304754M
Recombinant protein of human S100 calcium binding protein Z (S100Z), 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204754 protein sequence
Red=Cloning site Green=Tags(s) MPTQLEMAMDTMIRIFHRYSGKARKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEV DFNEFVVMVAALTVACNDYFVEQLKKKGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_570128 |
Locus ID | 170591 |
UniProt ID | Q8WXG8 |
Refseq Size | 1164 |
Cytogenetics | 5q13.3 |
Refseq ORF | 297 |
Synonyms | Gm625; S100-zeta |
Summary | Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expression patterns. For additional background information on S100 proteins, see MIM 114085.[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |