United States
Germany
Japan
United Kingdom
China
RBPJK (RBPJ) (NM_203283) Human Mass Spec Standard
CAT＃: PH304791
RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976028)
View other "RBPJK" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
| Product Data | |
| Description | RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976028) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204791 |
| Predicted MW | 54.1 kDa |
| Protein Sequence |
>RC204791 protein sequence
Red=Cloning site Green=Tags(s) MGGCRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKE QMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGV FLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLL DDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTER MYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGG GDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGII YSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_976028 |
| RefSeq Size | 5762 |
| RefSeq ORF | 1455 |
| Synonyms | AOS3; CBF-1; CBF1; csl; IGKJRB; IGKJRB1; KBF2; RBP-J; RBP-JK; RBP-J kappa; RBPJK; RBPSUH; SUH |
| Locus ID | 3516 |
| Cytogenetics | 4p15.2 |
| Summary | The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by recruiting chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins to Notch signaling pathway genes. Several transcript variants encoding different isoforms have been found for this gene, and several pseudogenes of this gene exist on chromosome 9. [provided by RefSeq, Oct 2013] |
| Protein Families | Transcription Factors |
| Protein Pathways | Notch signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401647 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC404367 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404368 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430905 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401647 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1 |
CNY 4,840.00 |
|
| LY404367 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3 |
CNY 3,080.00 |
|
| LY404368 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4 |
CNY 3,080.00 |
|
| PH309094 | RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976029) |
CNY 19,520.00 |
|
| TP304791 | Recombinant protein of human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP309094 | Recombinant protein of human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP760429 | Purified recombinant protein of Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
