SLIRP (NM_031210) Human Mass Spec Standard
CAT#: PH305002
C14orf156 MS Standard C13 and N15-labeled recombinant protein (NP_112487)
View other "SLIRP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | C14orf156 MS Standard C13 and N15-labeled recombinant protein (NP_112487) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205002 |
Predicted MW | 12.3 kDa |
Protein Sequence |
>RC205002 protein sequence
Red=Cloning site Green=Tags(s) MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSE EGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112487 |
RefSeq Size | 420 |
RefSeq ORF | 327 |
Synonyms | C14orf156; DC50; PD04872 |
Locus ID | 81892 |
Cytogenetics | 14q24.3 |
Summary | Steroid receptor RNA activator (SRA, or SRA1; MIM 603819) is a complex RNA molecule containing multiple stable stem-loop structures that functions in coactivation of nuclear receptors. SLIRP interacts with stem-loop structure-7 of SRA (STR7) and modulates nuclear receptor transactivation (Hatchell et al., 2006 [PubMed 16762838]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410590 | SLIRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410590 | Transient overexpression lysate of chromosome 14 open reading frame 156 (C14orf156) |
CNY 3,080.00 |
|
TP305002 | Recombinant protein of human chromosome 14 open reading frame 156 (C14orf156), 20 µg |
CNY 2,900.00 |