DNAJC5B (NM_033105) Human Mass Spec Standard
CAT#: PH305251
DNAJC5B MS Standard C13 and N15-labeled recombinant protein (NP_149096)
View other "DNAJC5B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | DNAJC5B MS Standard C13 and N15-labeled recombinant protein (NP_149096) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205251 |
Predicted MW | 22.5 kDa |
Protein Sequence |
>RC205251 protein sequence
Red=Cloning site Green=Tags(s) MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAI LTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHC RPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_149096 |
RefSeq Size | 1398 |
RefSeq ORF | 597 |
Synonyms | CSP-beta |
Locus ID | 85479 |
Cytogenetics | 8q13.1 |
Summary | This gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein 70, is thought to regulate the proper folding of other proteins. The orthologous mouse protein is membrane-associated and is targeted to the trans-golgi network. [provided by RefSeq, Mar 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409749 | DNAJC5B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409749 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B) |
CNY 3,080.00 |
|
TP305251 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B), 20 µg |
CNY 2,900.00 |
其它DNAJC5B产品