ID2 (NM_002166) Human Mass Spec Standard
CAT#: PH305324
ID2 MS Standard C13 and N15-labeled recombinant protein (NP_002157)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ID2 MS Standard C13 and N15-labeled recombinant protein (NP_002157) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205324 |
Predicted MW | 14.9 kDa |
Protein Sequence |
>RC205324 protein sequence
Red=Cloning site Green=Tags(s) MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVID YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002157 |
RefSeq Size | 1402 |
RefSeq ORF | 402 |
Synonyms | bHLHb26; GIG8; ID2A; ID2H |
Locus ID | 3398 |
Cytogenetics | 2p25.1 |
Summary | The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Aug 2011] |
Protein Families | ES Cell Differentiation/IPS, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400786 | ID2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400786 | Transient overexpression lysate of inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2) |
CNY 3,080.00 |
|
TP305324 | Recombinant protein of human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2), 20 µg |
CNY 2,900.00 |