MTHFS (NM_006441) Human Mass Spec Standard
CAT#: PH305749
MTHFS MS Standard C13 and N15-labeled recombinant protein (NP_006432)
View other "MTHFS" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MTHFS MS Standard C13 and N15-labeled recombinant protein (NP_006432) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205749 |
Predicted MW | 23.3 kDa |
Protein Sequence |
>RC205749 protein sequence
Red=Cloning site Green=Tags(s) MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKD IFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFD KHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006432 |
RefSeq Size | 2346 |
RefSeq ORF | 609 |
Synonyms | HsT19268; NEDMEHM |
Locus ID | 10588 |
Cytogenetics | 15q25.1 |
Summary | The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
Protein Pathways | Metabolic pathways, One carbon pool by folate |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416629 | MTHFS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416629 | Transient overexpression lysate of 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) (MTHFS) |
CNY 3,080.00 |
|
TP305749 | Recombinant protein of human 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) (MTHFS), 20 µg |
CNY 2,900.00 |
|
TP721196 | Purified recombinant protein of Human 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) (MTHFS), transcript variant 1 |
CNY 3,140.00 |