Centrin 1 (CETN1) (NM_004066) Human Mass Spec Standard
CAT#: PH306285
CETN1 MS Standard C13 and N15-labeled recombinant protein (NP_004057)
View other "Centrin 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CETN1 MS Standard C13 and N15-labeled recombinant protein (NP_004057) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206285 |
Predicted MW | 19.6 kDa |
Protein Sequence |
>RC206285 protein sequence
Red=Cloning site Green=Tags(s) MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMK KMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDE ELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004057 |
RefSeq Size | 1161 |
RefSeq ORF | 516 |
Synonyms | CEN1; CETN |
Locus ID | 1068 |
Cytogenetics | 18p11.32 |
Summary | The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401316 | CETN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401316 | Transient overexpression lysate of centrin, EF-hand protein, 1 (CETN1) |
CNY 3,080.00 |
|
TP306285 | Recombinant protein of human centrin, EF-hand protein, 1 (CETN1), 20 µg |
CNY 2,900.00 |
其它Centrin 1产品