RGS3 (NM_134427) Human Mass Spec Standard
CAT#: PH306471
RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_602299)
View other "RGS3" proteins (16)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_602299) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206471 |
Predicted MW | 100.9 kDa |
Protein Sequence |
>RC206471 protein sequence
Red=Cloning site Green=Tags(s) MNRFNGLCKVCSERRYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEH WKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQR HSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQLLRPVYQEDTIP EESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSYGTYVTLAPKVLVFPVFVQPLD LCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLKF CVLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPGA EDSPPSKEPSPGQELPPGQDLPPSKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEPP PAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLLA ATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDEDTSDDNYGERS EAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDTTLHCSDGEGAASTWGMPSPST LKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAKDMKNKLGIFRRRNESPGAPPAG KADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASK AKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQ KKMSPPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_602299 |
RefSeq Size | 1733 |
RefSeq ORF | 2754 |
Synonyms | C2PA; RGP3 |
Locus ID | 5998 |
Cytogenetics | 9q32 |
Summary | This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402835 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC403390 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408751 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408949 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413532 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402835 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 2 |
CNY 4,840.00 |
|
LY403390 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 5 |
CNY 3,080.00 |
|
LY408751 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 4 |
CNY 3,080.00 |
|
LY408949 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 1 |
CNY 3,080.00 |
|
LY413532 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 3 |
CNY 4,840.00 |
|
PH324058 | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_570613) |
CNY 19,520.00 |
|
PH324111 | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_066929) |
CNY 19,520.00 |
|
TP306471 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP324058 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP324111 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760493 | Purified recombinant protein of Human regulator of G-protein signaling 3 (RGS3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |