CSRP1 (NM_004078) Human Mass Spec Standard
CAT#: PH307109
CSRP1 MS Standard C13 and N15-labeled recombinant protein (NP_004069)
View other "CSRP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CSRP1 MS Standard C13 and N15-labeled recombinant protein (NP_004069) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207109 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC207109 protein sequence
Red=Cloning site Green=Tags(s) MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKG YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWH KACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004069 |
RefSeq Size | 1970 |
RefSeq ORF | 579 |
Synonyms | CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141; HEL-S-286 |
Locus ID | 1465 |
Cytogenetics | 1q32.1 |
Summary | This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418221 | CSRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418221 | Transient overexpression lysate of cysteine and glycine-rich protein 1 (CSRP1), transcript variant 1 |
CNY 3,080.00 |
|
TP307109 | Recombinant protein of human cysteine and glycine-rich protein 1 (CSRP1), transcript variant 1, 20 µg |
CNY 2,900.00 |