FYN (NM_153048) Human Mass Spec Standard
CAT#: PH307620
FYN MS Standard C13 and N15-labeled recombinant protein (NP_694593)
View other "FYN" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FYN MS Standard C13 and N15-labeled recombinant protein (NP_694593) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207620 |
Predicted MW | 54.5 kDa |
Protein Sequence |
>RC207620 protein sequence
Red=Cloning site Green=Tags(s) MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN GGYYITTRAQFETLQQLVQHYSGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSE EPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICK IADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREV LEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_694593 |
RefSeq Size | 2959 |
RefSeq ORF | 1446 |
Synonyms | p59-FYN; SLK; SYN |
Locus ID | 2534 |
Cytogenetics | 6q21 |
Summary | This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Adherens junction, Axon guidance, Fc epsilon RI signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, Pathogenic Escherichia coli infection, Prion diseases, T cell receptor signaling pathway, Viral myocarditis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400745 | FYN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC403505 | FYN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC407122 | FYN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400745 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1 |
CNY 4,840.00 |
|
LY403505 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2 |
CNY 4,840.00 |
|
LY407122 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3 |
CNY 3,080.00 |
|
PH319374 | FYN MS Standard C13 and N15-labeled recombinant protein (NP_694592) |
CNY 19,520.00 |
|
PH324691 | FYN MS Standard C13 and N15-labeled recombinant protein (NP_002028) |
CNY 19,520.00 |
|
TP307620 | Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP319374 | Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP324691 | Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1, 20 µg |
CNY 2,900.00 |