VPS4A (NM_013245) Human Mass Spec Standard
CAT#: PH308099
VPS4A MS Standard C13 and N15-labeled recombinant protein (NP_037377)
View other "VPS4A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | VPS4A MS Standard C13 and N15-labeled recombinant protein (NP_037377) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208099 |
Predicted MW | 48.9 kDa |
Protein Sequence |
>RC208099 protein sequence
Red=Cloning site Green=Tags(s) MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKL KDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALK EAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVK NLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSA IRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQ SATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA DDLLKVKKFSEDFGQES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_037377 |
RefSeq Size | 2211 |
RefSeq ORF | 1311 |
Synonyms | CIMDAG; SKD1; SKD1A; SKD2; VPS4; VPS4-1 |
Locus ID | 27183 |
Cytogenetics | 16q22.1 |
Summary | The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. The mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be really an yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 16; the gene for the other resides on chromosome 18. [provided by RefSeq, Jul 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415707 | VPS4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415707 | Transient overexpression lysate of vacuolar protein sorting 4 homolog A (S. cerevisiae) (VPS4A) |
CNY 3,080.00 |
|
TP308099 | Recombinant protein of human vacuolar protein sorting 4 homolog A (S. cerevisiae) (VPS4A), 20 µg |
CNY 2,900.00 |