CTBP1 (NM_001012614) Human Mass Spec Standard
CAT#: PH308594
CTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001012632)
View other "CTBP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001012632) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208594 |
Predicted MW | 46.4 kDa |
Protein Sequence |
>RC208594 protein sequence
Red=Cloning site Green=Tags(s) MSGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITL TREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATWLHQALR EGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVS TLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDV HESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATH WASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEA DRDHASDQL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001012632 |
RefSeq Size | 2483 |
RefSeq ORF | 1287 |
Synonyms | BARS; HADDTS |
Locus ID | 1487 |
Cytogenetics | 4p16.3 |
Summary | This gene encodes a protein that binds to the C-terminus of adenovirus E1A proteins. This phosphoprotein is a transcriptional repressor and may play a role during cellular proliferation. This protein and the product of a second closely related gene, CTBP2, can dimerize. Both proteins can also interact with a polycomb group protein complex which participates in regulation of gene expression during development. Alternative splicing of transcripts from this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Pathways | Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400528 | CTBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422883 | CTBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400528 | Transient overexpression lysate of C-terminal binding protein 1 (CTBP1), transcript variant 1 |
CNY 3,080.00 |
|
LY422883 | Transient overexpression lysate of C-terminal binding protein 1 (CTBP1), transcript variant 2 |
CNY 3,080.00 |
|
PH310529 | CTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001319) |
CNY 19,520.00 |
|
TP308594 | Recombinant protein of human C-terminal binding protein 1 (CTBP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP310529 | Recombinant protein of human C-terminal binding protein 1 (CTBP1), transcript variant 1, 20 µg |
CNY 2,900.00 |