EIF4EBP2 (NM_004096) Human Mass Spec Standard
CAT#: PH308664
EIF4EBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004087)
View other "EIF4EBP2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | EIF4EBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004087) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208664 |
Predicted MW | 12.9 kDa |
Protein Sequence |
>RC208664 protein sequence
Red=Cloning site Green=Tags(s) MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQT PPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004087 |
RefSeq Size | 7531 |
RefSeq ORF | 360 |
Synonyms | 4EBP2; PHASII |
Locus ID | 1979 |
Cytogenetics | 10q22.1 |
Summary | This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq, Oct 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418216 | EIF4EBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418216 | Transient overexpression lysate of eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2) |
CNY 3,080.00 |
|
TP308664 | Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2), 20 µg |
CNY 2,900.00 |
|
TP720559 | Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2) |
CNY 3,140.00 |
其它EIF4EBP2产品