Host cell factor C1 regulator 1 (HCFC1R1) (NM_017885) Human Mass Spec Standard
CAT#: PH309047
HCFC1R1 MS Standard C13 and N15-labeled recombinant protein (NP_060355)
View other "Host cell factor C1 regulator 1" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HCFC1R1 MS Standard C13 and N15-labeled recombinant protein (NP_060355) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209047 |
Predicted MW | 15.3 kDa |
Protein Sequence |
>RC209047 protein sequence
Red=Cloning site Green=Tags(s) MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQ LSLHNDHPYCSPPMTFSPALPPLRSPCSELLLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060355 |
RefSeq Size | 1023 |
RefSeq ORF | 414 |
Synonyms | HPIP |
Locus ID | 54985 |
Cytogenetics | 16p13.3 |
Summary | Regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413468 | HCFC1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424320 | HCFC1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424321 | HCFC1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413468 | Transient overexpression lysate of host cell factor C1 regulator 1 (XPO1 dependent) (HCFC1R1), transcript variant 1 |
CNY 3,080.00 |
|
LY424320 | Transient overexpression lysate of host cell factor C1 regulator 1 (XPO1 dependent) (HCFC1R1), transcript variant 2 |
CNY 3,080.00 |
|
LY424321 | Transient overexpression lysate of host cell factor C1 regulator 1 (XPO1 dependent) (HCFC1R1), transcript variant 3 |
CNY 3,080.00 |
|
TP309047 | Recombinant protein of human host cell factor C1 regulator 1 (XPO1 dependent) (HCFC1R1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760844 | Purified recombinant protein of Human host cell factor C1 regulator 1 (XPO1 dependent) (HCFC1R1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Host cell factor C1 regulator 1产品