NKIRAS2 (NM_017595) Human Mass Spec Standard
CAT#: PH309464
NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_060065)
View other "NKIRAS2" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_060065) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209464 |
Predicted MW | 21.5 kDa |
Protein Sequence |
>RC209464 protein sequence
Red=Cloning site Green=Tags(s) MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAE LPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAK SEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060065 |
RefSeq Size | 2474 |
RefSeq ORF | 573 |
Synonyms | kappaB-Ras2; KBRAS2 |
Locus ID | 28511 |
Cytogenetics | 17q21.2 |
Summary | Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and nuclear localization of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413685 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424331 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425022 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428581 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413685 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 2 |
CNY 3,080.00 |
|
LY424331 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 1 |
CNY 3,080.00 |
|
LY428581 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 3 |
CNY 3,080.00 |
|
PH323273 | NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001001349) |
CNY 19,520.00 |
|
PH326742 | NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001138399) |
CNY 14,250.00 |
|
TP309464 | Recombinant protein of human NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP323273 | Recombinant protein of human NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP326742 | Purified recombinant protein of Homo sapiens NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它NKIRAS2产品