United States
Germany
Japan
United Kingdom
China
AMSH (STAMBP) (NM_006463) Human Mass Spec Standard
CAT＃: PH309475
STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_006454)
View other "AMSH" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_006454) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209475 |
| Predicted MW | 48.1 kDa |
| Protein Sequence |
>RC209475 protein sequence
Red=Cloning site Green=Tags(s) MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF IEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQ ELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPT LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVE TCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI TDLR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006454 |
| RefSeq Size | 6386 |
| RefSeq ORF | 1272 |
| Synonyms | AMSH; MICCAP |
| Locus ID | 10617 |
| Cytogenetics | 2p13.1 |
| Summary | Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403869 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC404497 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416628 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403869 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 3 |
CNY 4,840.00 |
|
| LY404497 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 2 |
CNY 3,080.00 |
|
| LY416628 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 1 |
CNY 3,080.00 |
|
| PH301090 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_964010) |
CNY 19,520.00 |
|
| PH317643 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_998787) |
CNY 19,520.00 |
|
| TP301090 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP309475 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP317643 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 3, 20 µg |
CNY 2,900.00 |
