AMSH (STAMBP) (NM_213622) Human Recombinant Protein
CAT#: TP317643
Recombinant protein of human STAM binding protein (STAMBP), transcript variant 3, 20 µg
View other "AMSH" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217643 protein sequence
Red=Cloning site Green=Tags(s) MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF IEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQ ELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPT LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVE TCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI TDLR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_998787 |
Locus ID | 10617 |
UniProt ID | O95630, A0A140VK54 |
Refseq Size | 6709 |
Cytogenetics | 2p13.1 |
Refseq ORF | 1272 |
Synonyms | AMSH; MICCAP |
Summary | Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403869 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC404497 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416628 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403869 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 3 |
CNY 4,840.00 |
|
LY404497 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 2 |
CNY 3,080.00 |
|
LY416628 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 1 |
CNY 3,080.00 |
|
PH301090 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_964010) |
CNY 19,520.00 |
|
PH309475 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_006454) |
CNY 19,520.00 |
|
PH317643 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_998787) |
CNY 19,520.00 |
|
TP301090 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP309475 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 1, 20 µg |
CNY 2,900.00 |