RAB22A (NM_020673) Human Mass Spec Standard
CAT#: PH309511
RAB22A MS Standard C13 and N15-labeled recombinant protein (NP_065724)
View other "RAB22A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | RAB22A MS Standard C13 and N15-labeled recombinant protein (NP_065724) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209511 |
Predicted MW | 21.9 kDa |
Protein Sequence |
>RC209511 protein sequence
Red=Cloning site Green=Tags(s) MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRAL APMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSI HAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065724 |
RefSeq Size | 8702 |
RefSeq ORF | 582 |
Locus ID | 57403 |
Cytogenetics | 20q13.32 |
Summary | The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Microtubule-dependent endosomal sorting of clathrin-independent cargo by Hook1
,null,
The Journal of Cell Biology
,PubMed ID 23589492
[RAB22A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402804 | RAB22A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402804 | Transient overexpression lysate of RAB22A, member RAS oncogene family (RAB22A) |
CNY 3,080.00 |
|
TP309511 | Recombinant protein of human RAB22A, member RAS oncogene family (RAB22A), 20 µg |
CNY 2,900.00 |