MSC (NM_005098) Human Mass Spec Standard
CAT#: PH309818
MSC MS Standard C13 and N15-labeled recombinant protein (NP_005089)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MSC MS Standard C13 and N15-labeled recombinant protein (NP_005089) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209818 |
Predicted MW | 22.1 kDa |
Protein Sequence |
>RC209818 protein sequence
Red=Cloning site Green=Tags(s) MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGC KRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPD TKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRPDSDTKEVSAANRLCGTTA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005089 |
RefSeq Size | 2075 |
RefSeq ORF | 618 |
Synonyms | ABF-1; ABF1; bHLHa22; MYOR |
Locus ID | 9242 |
Cytogenetics | 8q13.3 |
Summary | The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable of inhibiting the transactivation capability of E47, an E2A protein, in mammalian cells. This gene is a downstream target of the B-cell receptor signal transduction pathway. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417513 | MSC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417513 | Transient overexpression lysate of musculin (activated B-cell factor-1) (MSC) |
CNY 3,080.00 |
|
TP309818 | Recombinant protein of human musculin (activated B-cell factor-1) (MSC), 20 µg |
CNY 2,900.00 |