ATG5 (NM_004849) Human Mass Spec Standard
CAT#: PH310563
ATG5 MS Standard C13 and N15-labeled recombinant protein (NP_004840)
View other "ATG5" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ATG5 MS Standard C13 and N15-labeled recombinant protein (NP_004840) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210563 |
Predicted MW | 32.4 kDa |
Protein Sequence |
>RC210563 protein sequence
Red=Cloning site Green=Tags(s) MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWF EYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQ VINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADG QLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004840 |
RefSeq Size | 3260 |
RefSeq ORF | 825 |
Synonyms | APG5; APG5-LIKE; APG5L; ASP; hAPG5; SCAR25 |
Locus ID | 9474 |
Cytogenetics | 6q21 |
Summary | The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle formation, mitochondrial quality control after oxidative damage, negative regulation of the innate antiviral immune response, lymphocyte development and proliferation, MHC II antigen presentation, adipocyte differentiation, and apoptosis. Several transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Regulation of autophagy, RIG-I-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401532 | ATG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401532 | Transient overexpression lysate of ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5) |
CNY 3,080.00 |
|
TP310563 | Recombinant protein of human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 20 µg |
CNY 2,900.00 |
|
TP720995 | Purified recombinant protein of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5) |
CNY 3,140.00 |