alpha Synuclein (SNCA) (NM_000345) Human Mass Spec Standard
CAT#: PH310606
SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336)
View other "alpha Synuclein" proteins (16)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210606 |
Predicted MW | 14.3 kDa |
Protein Sequence |
>RC210606 representing NM_000345
Red=Cloning site Green=Tags(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000336 |
RefSeq Size | 1543 |
RefSeq ORF | 420 |
Synonyms | NACP; PARK1; PARK4; PD1 |
Locus ID | 6622 |
Cytogenetics | 4q22.1 |
Summary | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400127 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416080 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431763 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431764 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400127 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CNY 3,080.00 |
|
LY416080 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 |
CNY 3,080.00 |
|
LY431763 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2 |
CNY 3,080.00 |
|
LY431764 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3 |
CNY 3,080.00 |
|
PH321446 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292) |
CNY 19,520.00 |
|
TP310606 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP140, 20 µg |
CNY 2,900.00 |
|
TP321446 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112, 20 µg |
CNY 2,900.00 |
|
TP328735 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP328736 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP720923 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CNY 4,260.00 |
|
TP721177 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CNY 4,550.00 |
|
TP750040 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, full length, Tag free, expressed in E. coli, 100ug |
CNY 4,020.00 |
其它alpha Synuclein产品