PACAP (ADCYAP1) (NM_001117) Human Mass Spec Standard
CAT#: PH310851
ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001108)
View other "PACAP" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001108) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210851 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC210851 protein sequence
Red=Cloning site Green=Tags(s) MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001108 |
RefSeq Size | 3259 |
RefSeq ORF | 528 |
Synonyms | PACAP |
Locus ID | 116 |
Cytogenetics | 18p11.32 |
Summary | This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400450 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420506 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426082 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400450 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2 |
CNY 3,080.00 |
|
LY420506 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 |
CNY 3,080.00 |
|
LY426082 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 |
CNY 3,080.00 |
|
PH321298 | ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001093203) |
CNY 19,520.00 |
|
TP310851 | Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP321298 | Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, 20 µg |
CNY 2,900.00 |