PACAP (ADCYAP1) (NM_001099733) Human Recombinant Protein
CAT#: TP321298
Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, 20 µg
View other "PACAP" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221298 protein sequence
Red=Cloning site Green=Tags(s) MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001093203 |
Locus ID | 116 |
UniProt ID | P18509 |
Refseq Size | 3187 |
Cytogenetics | 18p11.32 |
Refseq ORF | 528 |
Synonyms | PACAP |
Summary | This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400450 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420506 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426082 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400450 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2 |
CNY 3,080.00 |
|
LY420506 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 |
CNY 3,080.00 |
|
LY426082 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 |
CNY 3,080.00 |
|
PH310851 | ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001108) |
CNY 19,520.00 |
|
PH321298 | ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001093203) |
CNY 19,520.00 |
|
TP310851 | Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, 20 µg |
CNY 2,900.00 |