ERP29 (NM_006817) Human Mass Spec Standard
CAT#: PH310918
ERP29 MS Standard C13 and N15-labeled recombinant protein (NP_006808)
View other "ERP29" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ERP29 MS Standard C13 and N15-labeled recombinant protein (NP_006808) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210918 |
Predicted MW | 29 kDa |
Protein Sequence |
>RC210918 protein sequence
Red=Cloning site Green=Tags(s) MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQ DEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGA IQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKIL DQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006808 |
RefSeq Size | 1472 |
RefSeq ORF | 783 |
Synonyms | C12orf8; ERp28; ERp31; HEL-S-107; PDI-DB; PDIA9 |
Locus ID | 10961 |
Cytogenetics | 12q24.13 |
Summary | This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402039 | ERP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402039 | Transient overexpression lysate of endoplasmic reticulum protein 29 (ERP29), transcript variant 1 |
CNY 3,080.00 |
|
TP310918 | Recombinant protein of human endoplasmic reticulum protein 29 (ERP29), transcript variant 1, 20 µg |
CNY 2,900.00 |