Kv beta 2 (KCNAB2) (NM_003636) Human Mass Spec Standard
CAT#: PH311690
KCNAB2 MS Standard C13 and N15-labeled recombinant protein (NP_003627)
View other "Kv beta 2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | KCNAB2 MS Standard C13 and N15-labeled recombinant protein (NP_003627) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211690 |
Predicted MW | 41 kDa |
Protein Sequence |
>RC211690 protein sequence
Red=Cloning site Green=Tags(s) MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAE QLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGL KASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPP ICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSE EGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHE IDSILGNKPYSKKDYRS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003627 |
RefSeq Size | 4224 |
RefSeq ORF | 1101 |
Synonyms | AKR6A5; HKvbeta2; HKvbeta2.1; HKvbeta2.2; KCNA2B; KV-BETA-2 |
Locus ID | 8514 |
Cytogenetics | 1p36.31 |
Summary | Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406850 | KCNAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418536 | KCNAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406850 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 2 |
CNY 3,080.00 |
|
LY418536 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1 |
CNY 3,080.00 |
|
PH314602 | KCNAB2 MS Standard C13 and N15-labeled recombinant protein (NP_742128) |
CNY 19,520.00 |
|
TP311690 | Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP314602 | Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Kv beta 2产品