Kv beta 2 (KCNAB2) (NM_003636) Human Recombinant Protein
CAT#: TP311690
Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1, 20 µg
View other "Kv beta 2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211690 protein sequence
Red=Cloning site Green=Tags(s) MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAE QLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGL KASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPP ICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSE EGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHE IDSILGNKPYSKKDYRS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003627 |
Locus ID | 8514 |
UniProt ID | Q13303, A1PR14 |
Refseq Size | 4224 |
Cytogenetics | 1p36.31 |
Refseq ORF | 1101 |
Synonyms | AKR6A5; HKvbeta2; HKvbeta2.1; HKvbeta2.2; KCNA2B; KV-BETA-2 |
Summary | Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406850 | KCNAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418536 | KCNAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406850 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 2 |
CNY 3,080.00 |
|
LY418536 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1 |
CNY 3,080.00 |
|
PH311690 | KCNAB2 MS Standard C13 and N15-labeled recombinant protein (NP_003627) |
CNY 19,520.00 |
|
PH314602 | KCNAB2 MS Standard C13 and N15-labeled recombinant protein (NP_742128) |
CNY 19,520.00 |
|
TP314602 | Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Kv beta 2产品