FBLIM1 (NM_001024216) Human Mass Spec Standard
CAT#: PH311828
FBLIM1 MS Standard C13 and N15-labeled recombinant protein (NP_001019387)
View other "FBLIM1" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | FBLIM1 MS Standard C13 and N15-labeled recombinant protein (NP_001019387) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211828 |
Predicted MW | 30.6 kDa |
Protein Sequence |
>RC211828 representing NM_001024216
Red=Cloning site Green=Tags(s) MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAA ATVPAAPMQLFNGDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQ DTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICE NPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001019387 |
RefSeq Size | 2793 |
RefSeq ORF | 828 |
Synonyms | CAL; FBLP-1; FBLP1 |
Locus ID | 54751 |
Cytogenetics | 1p36.21 |
Summary | This gene encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402597 | FBLIM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422622 | FBLIM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422623 | FBLIM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402597 | Transient overexpression lysate of filamin binding LIM protein 1 (FBLIM1), transcript variant 1 |
CNY 3,080.00 |
|
LY422622 | Transient overexpression lysate of filamin binding LIM protein 1 (FBLIM1), transcript variant 2 |
CNY 3,080.00 |
|
LY422623 | Transient overexpression lysate of filamin binding LIM protein 1 (FBLIM1), transcript variant 3 |
CNY 3,080.00 |
|
PH305764 | FBLIM1 MS Standard C13 and N15-labeled recombinant protein (NP_060026) |
CNY 19,520.00 |
|
TP305764 | Recombinant protein of human filamin binding LIM protein 1 (FBLIM1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311828 | Purified recombinant protein of Homo sapiens filamin binding LIM protein 1 (FBLIM1), transcript variant 3, 20 µg |
CNY 2,900.00 |