ZSCAN2 (NM_001007072) Human Mass Spec Standard
CAT#: PH311929
ZSCAN2 MS Standard C13 and N15-labeled recombinant protein (NP_001007073)
View other "ZSCAN2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | ZSCAN2 MS Standard C13 and N15-labeled recombinant protein (NP_001007073) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211929 |
Predicted MW | 16.2 kDa |
Protein Sequence |
>RC211929 representing NM_001007072
Red=Cloning site Green=Tags(s) MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVT RGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSETASC VHGCPV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001007073 |
RefSeq Size | 951 |
RefSeq ORF | 438 |
Synonyms | ZFP29; ZNF854 |
Locus ID | 54993 |
Cytogenetics | 15q25.2 |
Summary | The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423575 | ZSCAN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423575 | Transient overexpression lysate of zinc finger and SCAN domain containing 2 (ZSCAN2), transcript variant 3 |
CNY 3,080.00 |
|
TP311929 | Recombinant protein of human zinc finger and SCAN domain containing 2 (ZSCAN2), transcript variant 3, 20 µg |
CNY 2,900.00 |