HSD11B1 (NM_181755) Human Mass Spec Standard
CAT#: PH312093
HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_861420)
View other "HSD11B1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_861420) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212093 |
Predicted MW | 32.4 kDa |
Protein Sequence |
>RC212093 protein sequence
Red=Cloning site Green=Tags(s) MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKET LQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSM EVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSI TLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY STSYNMDRFINK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_861420 |
RefSeq Size | 1457 |
RefSeq ORF | 876 |
Synonyms | 11-beta-HSD1; 11-DH; CORTRD2; HDL; HSD11; HSD11B; HSD11L; SDR26C1 |
Locus ID | 3290 |
Cytogenetics | 1q32.2 |
Summary | The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, May 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401695 | HSD11B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405624 | HSD11B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401695 | Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1 |
CNY 3,080.00 |
|
LY405624 | Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2 |
CNY 3,080.00 |
|
PH303109 | HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_005516) |
CNY 19,520.00 |
|
TP303109 | Recombinant protein of human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312093 | Recombinant protein of human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它HSD11B1产品