PRAS40 (AKT1S1) (NM_001098633) Human Mass Spec Standard
CAT#: PH312216
AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092103)
View other "PRAS40" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092103) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212216 |
Predicted MW | 27.2 kDa |
Protein Sequence |
>RC212216 representing NM_001098633
Red=Cloning site Green=Tags(s) MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHR AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001092103 |
RefSeq Size | 1789 |
RefSeq ORF | 768 |
Synonyms | Lobe; PRAS40 |
Locus ID | 84335 |
Cytogenetics | 19q13.33 |
Summary | AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410168 | AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420655 | AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410168 | Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1 |
CNY 3,080.00 |
|
LY420655 | Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2 |
CNY 3,080.00 |
|
PH300919 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_115751) |
CNY 19,520.00 |
|
PH311995 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092102) |
CNY 19,520.00 |
|
TP300919 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311995 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP312216 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 3, 20 µg |
CNY 2,900.00 |