PRAS40 (AKT1S1) (NM_001098633) Human Recombinant Protein
CAT#: TP312216
Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 3, 20 µg
View other "PRAS40" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212216 representing NM_001098633
Red=Cloning site Green=Tags(s) MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHR AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001092103 |
Locus ID | 84335 |
UniProt ID | Q96B36 |
Refseq Size | 1789 |
Cytogenetics | 19q13.33 |
Refseq ORF | 768 |
Synonyms | Lobe; PRAS40 |
Summary | AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410168 | AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420655 | AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410168 | Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1 |
CNY 3,080.00 |
|
LY420655 | Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2 |
CNY 3,080.00 |
|
PH300919 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_115751) |
CNY 19,520.00 |
|
PH311995 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092102) |
CNY 19,520.00 |
|
PH312216 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092103) |
CNY 19,520.00 |
|
TP300919 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311995 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2, 20 µg |
CNY 2,900.00 |