MEMO1 (NM_015955) Human Mass Spec Standard
CAT#: PH313245
MEMO1 MS Standard C13 and N15-labeled recombinant protein (NP_057039)
View other "MEMO1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MEMO1 MS Standard C13 and N15-labeled recombinant protein (NP_057039) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213245 |
Predicted MW | 33.7 kDa |
Protein Sequence |
>RC213245 protein sequence
Red=Cloning site Green=Tags(s) MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSI TRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYT AKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIY RSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCR NWQDSSVSYAAGALTVH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057039 |
RefSeq Size | 1878 |
RefSeq ORF | 891 |
Synonyms | C2orf4; CGI-27; MEMO; NS5ATP7 |
Locus ID | 51072 |
Cytogenetics | 2p22.3 |
Summary | May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Is required for breast carcinoma cell migration.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414307 | MEMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427942 | MEMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414307 | Transient overexpression lysate of mediator of cell motility 1 (MEMO1), transcript variant 1 |
CNY 3,080.00 |
|
LY427942 | Transient overexpression lysate of mediator of cell motility 1 (MEMO1), transcript variant 2 |
CNY 3,080.00 |
|
TP313245 | Recombinant protein of human mediator of cell motility 1 (MEMO1), transcript variant 1, 20 µg |
CNY 2,900.00 |