ASRGL1 (NM_001083926) Human Mass Spec Standard
CAT#: PH314638
ASRGL1 MS Standard C13 and N15-labeled recombinant protein (NP_001077395)
View other "ASRGL1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ASRGL1 MS Standard C13 and N15-labeled recombinant protein (NP_001077395) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214638 |
Predicted MW | 31.9 kDa |
Protein Sequence |
>RC214638 representing NM_001083926
Red=Cloning site Green=Tags(s) MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLN TNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLV TERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYAD NDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTS TSMPWAAAKDGKLHFGIDPDDTTITDLP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001077395 |
RefSeq Size | 2424 |
RefSeq ORF | 924 |
Synonyms | ALP; ALP1; CRASH |
Locus ID | 80150 |
Cytogenetics | 11q12.3 |
Summary | Has both L-asparaginase and beta-aspartyl peptidase activity. May be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Is highly active with L-Asp beta-methyl ester. Besides, has catalytic activity toward beta-aspartyl dipeptides and their methyl esters, including beta-L-Asp-L-Phe, beta-L-Asp-L-Phe methyl ester (aspartame), beta-L-Asp-L-Ala, beta-L-Asp-L-Leu and beta-L-Asp-L-Lys. Does not have aspartylglucosaminidase activity and is inactive toward GlcNAc-L-Asn. Likewise, has no activity toward glutamine.[UniProtKB/Swiss-Prot Function] |
Protein Families | Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410905 | ASRGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421255 | ASRGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410905 | Transient overexpression lysate of asparaginase like 1 (ASRGL1), transcript variant 2 |
CNY 3,080.00 |
|
LY421255 | Transient overexpression lysate of asparaginase like 1 (ASRGL1), transcript variant 1 |
CNY 3,080.00 |
|
PH305645 | ASRGL1 MS Standard C13 and N15-labeled recombinant protein (NP_079356) |
CNY 19,520.00 |
|
TP305645 | Recombinant protein of human asparaginase like 1 (ASRGL1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP314638 | Recombinant protein of human asparaginase like 1 (ASRGL1), transcript variant 1, 20 µg |
CNY 2,900.00 |