United States
Germany
Japan
United Kingdom
China
GOLPH2 (GOLM1) (NM_016548) Human Mass Spec Standard
CAT＃: PH314745
GOLM1 MS Standard C13 and N15-labeled recombinant protein (NP_057632)
View other "GOLPH2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 3,080.00
Specifications
| Product Data | |
| Description | GOLM1 MS Standard C13 and N15-labeled recombinant protein (NP_057632) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214745 |
| Predicted MW | 45.2 kDa |
| Protein Sequence |
>RC214745 representing NM_016548
Red=Cloning site Green=Tags(s) MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEF QGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQ FQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRL QAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVV EDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD YNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057632 |
| RefSeq Size | 3080 |
| RefSeq ORF | 1203 |
| Synonyms | bA379P1.3; C9orf155; GOLPH2; GP73; HEL46; PSEC0257 |
| Locus ID | 51280 |
| Cytogenetics | 9q21.33 |
| Summary | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Sep 2009] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406091 | GOLM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413906 | GOLM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406091 | Transient overexpression lysate of golgi membrane protein 1 (GOLM1), transcript variant 2 |
CNY 3,080.00 |
|
| LY413906 | Transient overexpression lysate of golgi membrane protein 1 (GOLM1), transcript variant 1 |
CNY 3,080.00 |
|
| PH300086 | GOLM1 MS Standard C13 and N15-labeled recombinant protein (NP_808800) |
CNY 19,520.00 |
|
| TP300086 | Recombinant protein of human golgi membrane protein 1 (GOLM1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP314745 | Recombinant protein of human golgi membrane protein 1 (GOLM1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP721040 | Purified recombinant protein of Human golgi membrane protein 1 (GOLM1), transcript variant 2 |
CNY 1,800.00 |
