Gastrin Releasing Peptide (GRP) (NM_001012513) Human Mass Spec Standard
CAT#: PH315122
GRP MS Standard C13 and N15-labeled recombinant protein (NP_001012531)
View other "Gastrin Releasing Peptide" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | GRP MS Standard C13 and N15-labeled recombinant protein (NP_001012531) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215122 |
Predicted MW | 15.18 kDa |
Protein Sequence |
>RC215122 representing NM_001012513
Red=Cloning site Green=Tags(s) MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQ LREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDLVDSLLQVLNVKEGTPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001012531 |
RefSeq Size | 844 |
RefSeq ORF | 414 |
Synonyms | BN; GRP-10; preproGRP; proGRP |
Locus ID | 2922 |
Cytogenetics | 18q21.32 |
Summary | This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419540 | GRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422879 | GRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419540 | Transient overexpression lysate of gastrin-releasing peptide (GRP), transcript variant 1 |
CNY 3,080.00 |
|
LY422879 | Transient overexpression lysate of gastrin-releasing peptide (GRP), transcript variant 3 |
CNY 3,080.00 |
|
TP315122 | Purified recombinant protein of Homo sapiens gastrin-releasing peptide (GRP), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP790060 | Purified recombinant protein of Human gastrin-releasing peptide (GRP), isoform 3, residues Gly31-Pro98, with N-terminal HIS-ABP tag, expressed in E.coli, 100 ug |
CNY 1,940.00 |
其它Gastrin Releasing Peptide产品