United States
Germany
Japan
United Kingdom
China
TMS1 (PYCARD) (NM_013258) Human Mass Spec Standard
CAT＃: PH315592
PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_037390)
View other "TMS1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
热销推荐Specifications
| Product Data | |
| Description | PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_037390) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215592 |
| Predicted MW | 21.4 kDa |
| Protein Sequence |
>RC215592 representing NM_013258
Red=Cloning site Green=Tags(s) MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTA NVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKV LTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_037390 |
| RefSeq Size | 936 |
| RefSeq ORF | 585 |
| Synonyms | ASC; CARD5; TMS; TMS-1; TMS1 |
| Locus ID | 29108 |
| Cytogenetics | 16p11.2 |
| Summary | This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402233 | PYCARD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408042 | PYCARD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402233 | Transient overexpression lysate of PYD and CARD domain containing (PYCARD), transcript variant 1 |
CNY 3,080.00 |
|
| LY408042 | Transient overexpression lysate of PYD and CARD domain containing (PYCARD), transcript variant 3 |
CNY 3,080.00 |
|
| PH302409 | PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_660184) |
CNY 19,520.00 |
|
| PH324051 | PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_660183) |
CNY 19,520.00 |
|
| TP302409 | Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP315592 | Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP324051 | Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 2, 20 µg |
CNY 2,900.00 |
