RASSF2 (NM_014737) Human Mass Spec Standard
CAT#: PH316299
RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_055552)
View other "RASSF2" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_055552) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216299 |
Predicted MW | 37.6 kDa |
Protein Sequence |
>RC216299 representing NM_014737
Red=Cloning site Green=Tags(s) MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055552 |
RefSeq Size | 5426 |
RefSeq ORF | 978 |
Synonyms | CENP-34; RASFADIN |
Locus ID | 9770 |
Cytogenetics | 20p13 |
Summary | This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406875 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415073 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429435 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406875 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2 |
CNY 3,080.00 |
|
LY415073 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1 |
CNY 3,080.00 |
|
PH317404 | RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_739580) |
CNY 19,520.00 |
|
TP316299 | Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP317404 | Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2, 20 µg |
CNY 2,900.00 |