CLDN19 (NM_148960) Human Mass Spec Standard
CAT#: PH316887
CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_683763)
View other "CLDN19" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_683763) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216887 |
Predicted MW | 23 kDa |
Protein Sequence |
>RC216887 representing NM_148960
Red=Cloning site Green=Tags(s) MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGPYEGLWMSCASQSTGQVQCKLYDSL LALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWY ATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREP VVKLPASAKGPLGV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_683763 |
RefSeq Size | 2859 |
RefSeq ORF | 672 |
Synonyms | HOMG5 |
Locus ID | 149461 |
Cytogenetics | 1p34.2 |
Summary | The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocular abnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jun 2010] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407723 | CLDN19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426624 | CLDN19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407723 | Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 1 |
CNY 3,080.00 |
|
LY426624 | Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 2 |
CNY 3,080.00 |
|
PH325251 | CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_001116867) |
CNY 14,250.00 |
|
TP316887 | Recombinant protein of human claudin 19 (CLDN19), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325251 | Recombinant protein of human claudin 19 (CLDN19), transcript variant 2, 20 µg |
CNY 2,900.00 |