ABHD12 (NM_001042472) Human Mass Spec Standard
CAT#: PH316963
ABHD12 MS Standard C13 and N15-labeled recombinant protein (NP_001035937)
View other "ABHD12" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ABHD12 MS Standard C13 and N15-labeled recombinant protein (NP_001035937) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216963 |
Predicted MW | 44.9 kDa |
Protein Sequence |
>RC216963 representing NM_001042472
Red=Cloning site Green=Tags(s) MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKRALGRRKGVWL RLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGV WHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGD SVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIRE EAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAP ARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001035937 |
RefSeq Size | 1983 |
RefSeq ORF | 1194 |
Synonyms | ABHD12A; BEM46L2; C20orf22; dJ965G21.2; hABHD12; PHARC |
Locus ID | 26090 |
Cytogenetics | 20p11.21 |
Summary | This gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Jan 2011] |
Protein Families | Protease, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414447 | ABHD12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420926 | ABHD12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414447 | Transient overexpression lysate of abhydrolase domain containing 12 (ABHD12), transcript variant 2 |
CNY 3,080.00 |
|
LY420926 | Transient overexpression lysate of abhydrolase domain containing 12 (ABHD12), transcript variant 1 |
CNY 3,080.00 |
|
TP316963 | Recombinant protein of human abhydrolase domain containing 12 (ABHD12), transcript variant 1, 20 µg |
CNY 2,900.00 |