FGFR2 (NM_000141) Human Mass Spec Standard
CAT#: PH317098
FGFR2 MS Standard C13 and N15-labeled recombinant protein (NP_000132)
View other "FGFR2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 4,840.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | FGFR2 MS Standard C13 and N15-labeled recombinant protein (NP_000132) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217098 |
Predicted MW | 92.5 kDa |
Protein Sequence |
>RC217098 representing NM_000141
Red=Cloning site Green=Tags(s) MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVI SWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGA EDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVR NQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKV YSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGI SFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEG CFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL YVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAAR NVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLG GSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYL DLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000132 |
RefSeq Size | 4654 |
RefSeq ORF | 2463 |
Synonyms | BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25 |
Locus ID | 2263 |
Cytogenetics | 10q26.13 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Multiple alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome, Protein Kinase, Secreted Protein, Transmembrane |
Protein Pathways | Endocytosis, MAPK signaling pathway, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400050 | FGFR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC402962 | FGFR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400050 | Transient overexpression lysate of fibroblast growth factor receptor 2 (FGFR2), transcript variant 1 |
CNY 4,840.00 |
|
LY402962 | Transient overexpression lysate of fibroblast growth factor receptor 2 (FGFR2), transcript variant 2 |
CNY 4,840.00 |
|
TP317098 | Recombinant protein of human fibroblast growth factor receptor 2 (FGFR2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP700121 | Purified recombinant protein of human fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP710096 | Purified recombinant protein of Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 1, residues 22-377aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |