TRAF3 (NM_003300) Human Mass Spec Standard
CAT#: PH318682
TRAF3 MS Standard C13 and N15-labeled recombinant protein (NP_003291)
View other "TRAF3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TRAF3 MS Standard C13 and N15-labeled recombinant protein (NP_003291) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218682 |
Predicted MW | 64.5 kDa |
Protein Sequence |
>RC218682 protein sequence
Red=Cloning site Green=Tags(s) MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGH RFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKND CHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSV QTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNE SVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSM KSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF KQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV DTSDLPDP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003291 |
RefSeq Size | 7654 |
RefSeq ORF | 1704 |
Synonyms | CAP-1; CAP1; CD40bp; CRAF1; IIAE5; LAP1; RNF118 |
Locus ID | 7187 |
Cytogenetics | 14q32.32 |
Summary | The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. The protein also plays a role in the regulation of antiviral response. Mutations in this are associated with Encephalopathy, acute, infection-induced, herpes-specific 5. [provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome |
Protein Pathways | Pathways in cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403439 | TRAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418781 | TRAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403439 | Transient overexpression lysate of TNF receptor-associated factor 3 (TRAF3), transcript variant 1 |
CNY 3,080.00 |
|
LY418781 | Transient overexpression lysate of TNF receptor-associated factor 3 (TRAF3), transcript variant 3 |
CNY 3,080.00 |
|
TP318682 | Recombinant protein of human TNF receptor-associated factor 3 (TRAF3), transcript variant 3, 20 µg |
CNY 2,900.00 |