United States
Germany
Japan
United Kingdom
China
PMP22 (NM_153322) Human Mass Spec Standard
CAT＃: PH318781
PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_696997)
View other "PMP22" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_696997) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218781 |
| Predicted MW | 17.7 kDa |
| Protein Sequence |
>RC218781 representing NM_153322
Red=Cloning site Green=Tags(s) MLLLLLSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMI LSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYGFAYILAW VAFPLALLSGVIYVILRKRE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_696997 |
| RefSeq Size | 1669 |
| RefSeq ORF | 480 |
| Synonyms | CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110 |
| Locus ID | 5376 |
| Cytogenetics | 17p12 |
| Summary | This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Studies suggest two alternately used promoters drive tissue-specific expression. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403508 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407108 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424810 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430266 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403508 | Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 3 |
CNY 3,080.00 |
|
| LY407108 | Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 2 |
CNY 3,080.00 |
|
| LY424810 | Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 1 |
CNY 3,080.00 |
|
| PH316500 | PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_000295) |
CNY 19,520.00 |
|
| TP316500 | Recombinant protein of human peripheral myelin protein 22 (PMP22), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP318781 | Recombinant protein of human peripheral myelin protein 22 (PMP22), transcript variant 3, 20 µg |
CNY 2,900.00 |
