Uridine Phosphorylase 1 (UPP1) (NM_181597) Human Mass Spec Standard
CAT#: PH319125
UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_853628)
View other "Uridine Phosphorylase 1" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_853628) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219125 |
Predicted MW | 33.9 kDa |
Protein Sequence |
>RC219125 protein sequence
Red=Cloning site Green=Tags(s) MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIR CVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIG TSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCT LDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQ ISSPRNVLSEYQQRPQRLVSYFIKKKLSKA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_853628 |
RefSeq Size | 1857 |
RefSeq ORF | 930 |
Synonyms | UDRPASE; UP; UPASE; UPP |
Locus ID | 7378 |
Cytogenetics | 7p12.3 |
Summary | This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2'- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage of pyrimidine ribonucleosides. [provided by RefSeq, Oct 2016] |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405710 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418738 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429141 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405710 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 2 |
CNY 3,080.00 |
|
LY418738 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 |
CNY 3,080.00 |
|
LY429141 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 |
CNY 3,080.00 |
|
PH300406 | UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_003355) |
CNY 19,520.00 |
|
TP300406 | Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP319125 | Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720926 | Purified recombinant protein of Human uridine phosphorylase 1 (UPP1), transcript variant 1 |
CNY 1,800.00 |
其它Uridine Phosphorylase 1产品