Uridine Phosphorylase 1 (UPP1) (NM_003364) Human Recombinant Protein
CAT#: TP300406
Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 1, 20 µg
View other "Uridine Phosphorylase 1" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200406 protein sequence
Red=Cloning site Green=Tags(s) MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIR CVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIG TSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCT LDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQ ISSPRNVLSEYQQRPQRLVSYFIKKKLSKA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003355 |
Locus ID | 7378 |
UniProt ID | Q16831 |
Refseq Size | 1733 |
Cytogenetics | 7p12.3 |
Refseq ORF | 930 |
Synonyms | UDRPASE; UP; UPASE; UPP |
Summary | This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2'- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage of pyrimidine ribonucleosides. [provided by RefSeq, Oct 2016] |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405710 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418738 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429141 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405710 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 2 |
CNY 3,080.00 |
|
LY418738 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 |
CNY 3,080.00 |
|
LY429141 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 |
CNY 3,080.00 |
|
PH300406 | UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_003355) |
CNY 19,520.00 |
|
PH319125 | UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_853628) |
CNY 19,520.00 |
|
TP319125 | Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720926 | Purified recombinant protein of Human uridine phosphorylase 1 (UPP1), transcript variant 1 |
CNY 1,800.00 |
其它Uridine Phosphorylase 1产品